JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

COX4I2

Description	Cytochrome c oxidase subunit 4 isoform 2, mitochondrial

Gene and Protein Information

Gene ID	84701
Uniprot Accession IDs	Q96KJ9 Q6GTF4 Q9H0Z4
Ensembl ID	ENSG00000131055
Symbol	COX4L2 COX4 COX4B COX4-2 COX4L2 COXIV-2 dJ857M17.2
Chromosome	20
Family	Belongs to the cytochrome c oxidase IV family.
Sequence	MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469913	COX4I2	cytochrome c oxidase subunit 4I2	9598	VGNC:9832	OMA, EggNOG
Macaque	713095	COX4I2	cytochrome c oxidase subunit IV isoform 2 (lung)	9544		Inparanoid, OMA, EggNOG
Mouse	84682	Cox4i2	cytochrome c oxidase subunit 4I2	10090	MGI:2135755	Inparanoid, OMA, EggNOG
Rat	84683	Cox4i2	cytochrome c oxidase subunit 4i2	10116	RGD:69422	Inparanoid, OMA, EggNOG
Dog	485825	COX4I2	cytochrome c oxidase subunit 4I2	9615	VGNC:54289	Inparanoid, OMA, EggNOG
Horse	100053548	COX4I2	cytochrome c oxidase subunit 4I2	9796	VGNC:16802	Inparanoid, OMA, EggNOG
Cow	618339	COX4I2	cytochrome c oxidase subunit 4I2	9913	VGNC:27635	Inparanoid, OMA, EggNOG
Anole lizard		COX4I2	cytochrome c oxidase subunit 4I2 [Source:HGNC Symbol;Acc:HGNC:16232]	28377		Inparanoid, OMA, EggNOG
Zebrafish	393776	cox4i2	cytochrome c oxidase subunit IV isoform 2	7955	ZDB-GENE-040426-1775	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.