JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

DUSP23

Description	Dual specificity protein phosphatase 23

Gene and Protein Information

Gene ID	54935
Uniprot Accession IDs	Q9BVJ7 Q9NX48
Ensembl ID	ENSG00000158716
Symbol	LDP3 VHZ VHZ LDP3 MOSP LDP-3 DUSP25
Chromosome	1
Family	Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Sequence	MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746364	DUSP23	dual specificity phosphatase 23	9598	VGNC:524	OMA, EggNOG
Macaque	719474	DUSP23	dual specificity phosphatase 23	9544		Inparanoid, OMA, EggNOG
Mouse	68440	Dusp23	dual specificity phosphatase 23	10090	MGI:1915690	Inparanoid, OMA, EggNOG
Rat	360881	Dusp23	dual specificity phosphatase 23	10116	RGD:1309202	Inparanoid, OMA, EggNOG
Horse	100053524	DUSP23	dual specificity phosphatase 23	9796	VGNC:17354	Inparanoid, OMA, EggNOG
Cow	513978	DUSP23	dual specificity phosphatase 23	9913	VGNC:28257	Inparanoid, OMA, EggNOG
Opossum	100029973	DUSP23	dual specificity phosphatase 23	13616		Inparanoid, OMA, EggNOG
Anole lizard	100563895	dusp23	dual specificity phosphatase 23	28377		Inparanoid, OMA, EggNOG
Xenopus	496838	dusp23	dual specificity phosphatase 23	8364	XB-GENE-967743	Inparanoid, OMA, EggNOG
Zebrafish	436735	dusp23b	dual specificity phosphatase 23b	7955	ZDB-GENE-040718-163	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.