JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

BDNF

Description	Brain-derived neurotrophic factor

Gene and Protein Information

Gene ID	627
Uniprot Accession IDs	P23560 A7LA85 A7LA92 D3DQZ2 Q598Q1 Q6DN19 Q6YNR2 Q6YNR3 Q9BYY7 Q9UC24 BDNF
Ensembl ID	ENSG00000176697
Symbol	ANON2 BULN2
Chromosome	11
Family	Belongs to the NGF-beta family.
Sequence	MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	503511	BDNF	brain derived neurotrophic factor	9598	VGNC:11265	Inparanoid, OMA
Macaque	701245	BDNF	brain derived neurotrophic factor	9544		OMA, EggNOG
Mouse	12064	Bdnf	brain derived neurotrophic factor	10090	MGI:88145	Inparanoid, OMA, EggNOG
Rat	24225	Bdnf	brain-derived neurotrophic factor	10116	RGD:2202	Inparanoid, OMA, EggNOG
Dog		BDNF	brain derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:1033]	9615		OMA, EggNOG
Horse	100009689	BDNF	brain derived neurotrophic factor	9796		Inparanoid, OMA, EggNOG
Cow	617701	BDNF	brain derived neurotrophic factor	9913	VGNC:26461	Inparanoid, OMA, EggNOG
Pig	397495	BDNF	brain derived neurotrophic factor	9823		Inparanoid, OMA, EggNOG
Opossum		BDNF	brain derived neurotrophic factor [Source:HGNC Symbol;Acc:HGNC:1033]	13616		Inparanoid, OMA, EggNOG
Chicken	396186	BDNF	brain derived neurotrophic factor	9031	CGNC:9230	Inparanoid, OMA, EggNOG
Anole lizard	100564408	bdnf	brain derived neurotrophic factor	28377		Inparanoid, OMA, EggNOG
Xenopus	100037853	bdnf	brain-derived neurotrophic factor	8364	XB-GENE-955554	Inparanoid, OMA, EggNOG
Zebrafish	58118	bdnf	brain-derived neurotrophic factor	7955	ZDB-GENE-000412-1	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / growth factor / neurotrophic factor / Brain-derived neurotrophic factor

DTO Classes
protein / Signaling / Growth factor / Neurotrophic factor / Brain-derived neurotrophic factor

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.