JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
DLX5

DLX5

Description	Homeobox protein DLX-5

Gene and Protein Information

Gene ID	1749
Uniprot Accession IDs	P56178 B7Z4P3 Q9UPL1
Ensembl ID	ENSG00000105880
Symbol	SHFM1D
Chromosome	7
Family	Belongs to the distal-less homeobox family.
Sequence	MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	463554	DLX5	distal-less homeobox 5	9598	VGNC:4331	OMA, EggNOG
Mouse	13395	Dlx5	distal-less homeobox 5	10090	MGI:101926	Inparanoid, OMA, EggNOG
Rat	25431	Dlx5	distal-less homeobox 5	10116	RGD:2506	Inparanoid, OMA, EggNOG
Dog	482313	DLX5	distal-less homeobox 5	9615	VGNC:39992	Inparanoid, OMA, EggNOG
Horse	100052263	DLX5	distal-less homeobox 5	9796	VGNC:17222	Inparanoid, OMA, EggNOG
Cow	507415	DLX5	distal-less homeobox 5	9913	VGNC:28101	Inparanoid, OMA, EggNOG
Opossum	100012748	DLX5	distal-less homeobox 5	13616		Inparanoid, OMA, EggNOG
Chicken	373969	DLX5	distal-less homeobox 5	9031	CGNC:48983	Inparanoid, OMA
Anole lizard	100561571	dlx5	distal-less homeobox 5	28377		Inparanoid, OMA, EggNOG
Xenopus	447997	dlx5	distal-less homeobox 5	8364	XB-GENE-853057	Inparanoid, OMA, EggNOG
Zebrafish	30569	dlx5a	distal-less homeobox 5a	7955	ZDB-GENE-990415-49	Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein DLX-5
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein DLX-5

DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein DLX-5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.