JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
BCAM

BCAM

Description	Basal cell adhesion molecule

Gene and Protein Information

Gene ID	4059
Uniprot Accession IDs	P50895 A8MYF9 A9YWT5 A9YWT6 Q86VC7
Ensembl ID	ENSG00000187244
Symbol	LU MSK19 AU LU CD239 MSK19
Chromosome	19
Sequence	MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	744276	BCAM	basal cell adhesion molecule	9598	VGNC:2582	OMA, EggNOG
Macaque	714568	BCAM	basal cell adhesion molecule (Lutheran blood group)	9544		Inparanoid, OMA, EggNOG
Mouse	57278	Bcam	basal cell adhesion molecule	10090	MGI:1929940	Inparanoid, OMA, EggNOG
Rat	78958	Bcam	basal cell adhesion molecule (Lutheran blood group)	10116	RGD:68378	Inparanoid, OMA, EggNOG
Dog	484456	BCAM	basal cell adhesion molecule	9615	VGNC:49023	Inparanoid, OMA, EggNOG
Horse	100070622	BCAM	basal cell adhesion molecule	9796	VGNC:51000	Inparanoid, OMA, EggNOG
Cow	282862	BCAM	basal cell adhesion molecule	9913	VGNC:49138	Inparanoid, OMA, EggNOG
Pig	100738241	BCAM	basal cell adhesion molecule (Lutheran blood group)	9823		OMA, EggNOG
Anole lizard	103281770	bcam	basal cell adhesion molecule (Lutheran blood group)	28377		Inparanoid, OMA, EggNOG
Xenopus	100036718	bcam	basal cell adhesion molecule (Lutheran blood group)	8364	XB-GENE-921467	Inparanoid, OMA, EggNOG
Zebrafish	767689	bcam	basal cell adhesion molecule (Lutheran blood group)	7955	ZDB-GENE-060929-620	Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / cell adhesion molecule / immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule
protein / cell adhesion molecule / receptor / Basal cell adhesion molecule

DTO Classes
protein / Cell adhesion / Immunoglobulin superfamily cell adhesion molecule / Basal cell adhesion molecule

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.