This is a demo store. No orders will be fulfilled.

ANXA4

Description Annexin A4

Gene and Protein Information

Gene ID 307
Uniprot Accession IDs P09525 B4DDF9 Q96F33 Q9BWK1
Ensembl ID ENSG00000196975
Symbol ANX4 ANX4 P32.5 PIG28 PP4-X ZAP36 PAP-II HEL-S-274
Chromosome 2
Family Belongs to the annexin family.
Sequence
MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 459542 ANXA4 annexin A4 9598 VGNC:17 OMA, EggNOG
Macaque 701433 ANXA4 annexin A4 9544 Inparanoid, OMA, EggNOG
Mouse 11746 Anxa4 annexin A4 10090 MGI:88030 Inparanoid, OMA, EggNOG
Rat 79124 Anxa4 annexin A4 10116 RGD:621171 Inparanoid, OMA, EggNOG
Dog 606756 ANXA4 annexin A4 9615 VGNC:37941 Inparanoid, OMA, EggNOG
Horse 100050657 ANXA4 annexin A4 9796 VGNC:15363 Inparanoid, OMA, EggNOG
Cow 281625 ANXA4 annexin A4 9913 VGNC:25966 Inparanoid, OMA, EggNOG
Pig 100312960 ANXA4 annexin A4 9823 Inparanoid, OMA, EggNOG
Opossum 100032716 ANXA4 annexin A4 13616 Inparanoid, EggNOG
Xenopus 548801 anxa4 annexin A4 8364 XB-GENE-854498 Inparanoid, OMA, EggNOG
Zebrafish 353362 anxa4 annexin A4 7955 ZDB-GENE-030707-1 Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.