JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

BTG1

Description	Protein BTG1

Gene and Protein Information

Gene ID	694
Uniprot Accession IDs	P62324 P31607
Ensembl ID	ENSG00000133639
Symbol	APRO2
Chromosome	12
Family	Belongs to the BTG family.
Sequence	MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	12226	Btg1	B cell translocation gene 1, anti-proliferative	10090	MGI:88215	Inparanoid, OMA, EggNOG
Rat	29618	Btg1	BTG anti-proliferation factor 1	10116	RGD:2224	Inparanoid, OMA, EggNOG
Dog	100684605	BTG1	BTG anti-proliferation factor 1	9615	VGNC:38558	Inparanoid, OMA, EggNOG
Horse		BTG1	BTG anti-proliferation factor 1 [Source:HGNC Symbol;Acc:HGNC:1130]	9796		OMA, EggNOG
Cow	281032	BTG1	BTG anti-proliferation factor 1	9913	VGNC:26597	Inparanoid, OMA, EggNOG
Opossum		BTG1	BTG anti-proliferation factor 1 [Source:HGNC Symbol;Acc:HGNC:1130]	13616		Inparanoid, OMA, EggNOG
Chicken	396295	BTG1	BTG anti-proliferation factor 1	9031	CGNC:49739	Inparanoid, OMA, EggNOG
Anole lizard	100561441	btg1	BTG anti-proliferation factor 1	28377		Inparanoid, OMA, EggNOG
Xenopus	394522	btg1	B-cell translocation gene 1, anti-proliferative	8364	XB-GENE-1002920	Inparanoid, OMA, EggNOG
Zebrafish	114432	btg1	B-cell translocation gene 1, anti-proliferative	7955	ZDB-GENE-010726-1	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.