JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CRYAA

Description	Alpha-crystallin A chain

Gene and Protein Information

Gene ID	1404
Uniprot Accession IDs	P02489 Q53X53
Ensembl ID	ENSG00000160202
Symbol	CRYA1 HSPB4 CRT1 CRTL1
Chromosome	21
Family	Belongs to the small heat shock protein (HSP20) family.
Sequence	MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458589	LOC458589	alpha-crystallin A chain	9598		OMA, EggNOG
Macaque	722370	CRYAA	crystallin alpha A	9544		Inparanoid, EggNOG
Mouse	12954	Cryaa	crystallin, alpha A	10090	MGI:88515	Inparanoid, OMA, EggNOG
Rat	24273	Cryaa	crystallin, alpha A	10116	RGD:2413	Inparanoid, OMA, EggNOG
Dog	487786	CRYAA	crystallin alpha A	9615		Inparanoid, OMA, EggNOG
Horse	100051134	CRYAA	crystallin alpha A	9796		Inparanoid, OMA, EggNOG
Cow	281718	CRYAA	crystallin alpha A	9913		Inparanoid, OMA, EggNOG
Opossum	100014565	CRYAA	crystallin alpha A	13616		Inparanoid, OMA, EggNOG
Platypus	791110	CRYAA	crystallin alpha A	9258		Inparanoid, OMA, EggNOG
Chicken	418546	CRYAA	crystallin alpha A	9031	CGNC:12109	Inparanoid, OMA, EggNOG
Anole lizard	100555261	cryaa	crystallin alpha A	28377		Inparanoid, OMA, EggNOG
Xenopus	100488185	cryaa	crystallin alpha A	8364	XB-GENE-5940571	Inparanoid, OMA, EggNOG
Zebrafish	100000769	cryaa	crystallin, alpha A	7955	ZDB-GENE-020508-1	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.