JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CAMP

Description	Cathelicidin antimicrobial peptide

Gene and Protein Information

Gene ID	820
Uniprot Accession IDs	P49913 Q71SN9
Ensembl ID	ENSG00000164047
Symbol	CAP18 FALL39 LL37 CAP18 CRAMP HSD26 CAP-18 FALL39 FALL-39
Chromosome	3
Family	Belongs to the cathelicidin family.
Sequence	MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	741881	CAMP	cathelicidin antimicrobial peptide	9598	VGNC:1751	Inparanoid, OMA
Macaque	619186	CAMP	cathelicidin antimicrobial peptide	9544		Inparanoid, OMA
Mouse	12796	Camp	cathelicidin antimicrobial peptide	10090	MGI:108443	Inparanoid, OMA
Rat	316010	Camp	cathelicidin antimicrobial peptide	10116	RGD:1559878	Inparanoid, OMA
Dog	442947	CAMP	cathelicidin antimicrobial peptide	9615	VGNC:38688	Inparanoid, OMA
Horse	100034135	ECATH-3	myeloid cathelicidin 3	9796		Inparanoid, OMA
Cow	282164	CATHL1	cathelicidin 1	9913		Inparanoid, OMA
Chicken	414337	CATH1	cathelicidin-1	9031	CGNC:49912	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.