This is a demo store. No orders will be fulfilled.
| Description | Chromobox protein homolog 5 |
|---|
Gene and Protein Information
| Gene ID | 23468 |
|---|---|
| Uniprot Accession IDs | P45973 B2R8T9 |
| Ensembl ID | ENSG00000094916 |
| Symbol | HP1A HP1 HP1A HEL25 |
| Chromosome | 12 |
| Sequence |
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467011 | CBX5 | chromobox 5 | 9598 | VGNC:12873 | OMA, EggNOG |
| Macaque | 703477 | CBX5 | chromobox 5 | 9544 | Inparanoid, OMA | |
| Mouse | 12419 | Cbx5 | chromobox 5 | 10090 | MGI:109372 | Inparanoid, OMA |
| Rat | 300266 | Cbx5 | chromobox 5 | 10116 | RGD:1306619 | Inparanoid, OMA |
| Dog | 477593 | CBX5 | chromobox 5 | 9615 | VGNC:38767 | Inparanoid, OMA |
| Horse | 100062404 | CBX5 | chromobox 5 | 9796 | VGNC:16099 | Inparanoid, OMA |
| Cow | 538885 | CBX5 | chromobox 5 | 9913 | VGNC:26818 | Inparanoid, OMA |
| Anole lizard | 100556370 | cbx5 | chromobox 5 | 28377 | Inparanoid, OMA | |
| Xenopus | 394502 | cbx5 | chromobox 5 | 8364 | XB-GENE-972727 | Inparanoid, OMA |
| Zebrafish | 563396 | cbx5 | chromobox homolog 5 (HP1 alpha homolog, Drosophila) | 7955 | ZDB-GENE-030131-5553 | Inparanoid, OMA |
| C. elegans | 181450 | hpl-1 | HP1 Like (heterochromatin protein) | 6239 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Chromodomain / Chromobox protein homolog 5
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Chromodomain / Chromobox protein homolog 5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later