JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
BST1

BST1

Description	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

Gene and Protein Information

Gene ID	683
Uniprot Accession IDs	Q10588 B2R6A2 Q1XII0 Q5U0K0 Q96EN3
Ensembl ID	ENSG00000109743
Symbol	CD157
Chromosome	4
Family	Belongs to the ADP-ribosyl cyclase family.
Sequence	MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	461126	BST1	bone marrow stromal cell antigen 1	9598	VGNC:572	OMA, EggNOG
Macaque	722848	BST1	bone marrow stromal cell antigen 1	9544		OMA, EggNOG
Mouse	12182	Bst1	bone marrow stromal cell antigen 1	10090	MGI:105370	Inparanoid, OMA, EggNOG
Rat	81506	Bst1	bone marrow stromal cell antigen 1	10116	RGD:620344	Inparanoid, OMA, EggNOG
Dog	488820	BST1	bone marrow stromal cell antigen 1	9615	VGNC:38541	Inparanoid, OMA, EggNOG
Cow	616757	BST1	bone marrow stromal cell antigen 1	9913	VGNC:26581	Inparanoid, OMA, EggNOG
Pig	100625942	BST1	bone marrow stromal cell antigen 1	9823		OMA, EggNOG
Opossum	100015733	BST1	bone marrow stromal cell antigen 1	13616		Inparanoid, OMA, EggNOG
Chicken	422828	BST1	bone marrow stromal cell antigen 1	9031	CGNC:10784	Inparanoid, OMA
Xenopus		BST1	bone marrow stromal cell antigen 1 [Source:HGNC Symbol;Acc:HGNC:1118]	8364		OMA, EggNOG

Protein Classes

PANTHER Classes
protein / hydrolase / cyclase / ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
protein / hydrolase / glycosidase / ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

DTO Classes
protein / Enzyme / Lyase / Cyclase / ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.