JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CYP11B1

Description	Cytochrome P450 11B1, mitochondrial

Gene and Protein Information

Gene ID	1584
Uniprot Accession IDs	P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2
Ensembl ID	ENSG00000160882
Symbol	S11BH FHI CPN1 CYP11B P450C11
Chromosome	8
Family	Belongs to the cytochrome P450 family.
Sequence	MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	110115	Cyp11b1	cytochrome P450, family 11, subfamily b, polypeptide 1	10090	MGI:88583	Inparanoid, OMA
Dog	482071	CYP11B2	cytochrome P450, family 11, subfamily B, polypeptide 2	9615		Inparanoid, OMA
Opossum	100032885	LOC100032885	cytochrome P450 11B1, mitochondrial	13616		Inparanoid, OMA
Anole lizard	100560890	LOC100560890	cytochrome P450 11B, mitochondrial	28377		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.