JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CA3

Description	Carbonic anhydrase 3

Gene and Protein Information

Gene ID	761
Uniprot Accession IDs	P07451 B2R867 B3KUC8 O60842
Ensembl ID	ENSG00000164879
Symbol	Car3 CAIII
Chromosome	8
Family	Belongs to the alpha-carbonic anhydrase family.
Sequence	MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	703801	CA3	carbonic anhydrase 3	9544		Inparanoid, OMA, EggNOG
Mouse	12350	Car3	carbonic anhydrase 3	10090	MGI:88270	Inparanoid, OMA, EggNOG
Rat	54232	Car3	carbonic anhydrase 3	10116	RGD:2241	Inparanoid, OMA, EggNOG
Dog	487032	CA3	carbonic anhydrase 3	9615	VGNC:38611	Inparanoid, OMA, EggNOG
Horse	100050125	CA3	carbonic anhydrase 3	9796	VGNC:15964	Inparanoid, OMA, EggNOG
Cow	513212	CA3	carbonic anhydrase 3	9913	VGNC:26653	Inparanoid, OMA, EggNOG
Pig	494016	CA3	carbonic anhydrase 3	9823		Inparanoid, OMA, EggNOG
Opossum	100018604	CA3	carbonic anhydrase 3	13616		Inparanoid, OMA, EggNOG
Platypus		CA3	carbonic anhydrase 3 [Source:HGNC Symbol;Acc:HGNC:1374]	9258		OMA, EggNOG
Xenopus	100496328	ca3	carbonic anhydrase III	8364	XB-GENE-1007186	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.