JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

C1QBP

Description	Complement component 1 Q subcomponent-binding protein, mitochondrial

Gene and Protein Information

Gene ID	708
Uniprot Accession IDs	Q07021 Q2HXR8 Q9NNY8
Ensembl ID	ENSG00000108561
Symbol	GC1QBP HABP1 SF2P32 p32 HABP1 gC1qR GC1QBP SF2p32 gC1Q-R COXPD33 SF2AP32
Chromosome	17
Family	Belongs to the MAM33 family.
Sequence	MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	455252	C1QBP	complement C1q binding protein	9598	VGNC:9226	OMA, EggNOG
Macaque	711817	C1QBP	complement C1q binding protein	9544		OMA, EggNOG
Mouse	12261	C1qbp	complement component 1, q subcomponent binding protein	10090	MGI:1194505	Inparanoid, OMA, EggNOG
Rat	29681	C1qbp	complement C1q binding protein	10116	RGD:2230	Inparanoid, OMA, EggNOG
Dog	489450	C1QBP	complement C1q binding protein	9615	VGNC:38578	Inparanoid, OMA, EggNOG
Horse	100072802	C1QBP	complement C1q binding protein	9796	VGNC:51386	Inparanoid, OMA, EggNOG
Cow	518321	C1QBP	complement C1q binding protein	9913	VGNC:26618	Inparanoid, OMA, EggNOG
Opossum		C1QBP	complement C1q binding protein [Source:HGNC Symbol;Acc:HGNC:1243]	13616		Inparanoid, OMA, EggNOG
Chicken	395538	C1QBP	complement C1q binding protein	9031	CGNC:1156	Inparanoid, OMA, EggNOG
Anole lizard	100552432	c1qbp	complement C1q binding protein	28377		Inparanoid, OMA, EggNOG
Xenopus	100494551	c1qbp	complement component 1, q subcomponent binding protein	8364	XB-GENE-973232	Inparanoid, OMA, EggNOG
Zebrafish	334619	c1qbp	complement component 1, q subcomponent binding protein	7955	ZDB-GENE-050417-408	OMA, EggNOG
C. elegans	175441	cri-3	Conserved regulator of innate immunity protein 3	6239		Inparanoid, OMA, EggNOG
Fruitfly	37006	P32	CG6459 gene product from transcript CG6459-RA	7227	FBgn0034259	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.