This is a demo store. No orders will be fulfilled.
| Description | Oligodendrocyte transcription factor 1 |
|---|
Gene and Protein Information
| Gene ID | 116448 |
|---|---|
| Uniprot Accession IDs | Q8TAK6 Q7RTS0 Oligo1 |
| Ensembl ID | ENSG00000184221 |
| Symbol | BHLHB6 BHLHE21 BHLHB6 BHLHE21 |
| Chromosome | 21 |
| Sequence |
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 706574 | OLIG1 | oligodendrocyte transcription factor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 50914 | Olig1 | oligodendrocyte transcription factor 1 | 10090 | MGI:1355334 | Inparanoid, OMA, EggNOG |
| Rat | 60394 | Olig1 | oligodendrocyte transcription factor 1 | 10116 | RGD:621129 | Inparanoid, OMA, EggNOG |
| Dog | 487736 | OLIG1 | oligodendrocyte transcription factor 1 | 9615 | VGNC:53034 | Inparanoid, OMA, EggNOG |
| Cow | 539307 | OLIG1 | oligodendrocyte transcription factor 1 | 9913 | VGNC:32425 | Inparanoid, OMA, EggNOG |
| Pig | 100620095 | OLIG1 | oligodendrocyte transcription factor 1 | 9823 | OMA, EggNOG | |
| Opossum | 100026845 | OLIG1 | oligodendrocyte transcription factor 1 | 13616 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / nuclease / Oligodendrocyte transcription factor 1
protein / nucleic acid binding / basic helix-loop-helix transcription factor / Oligodendrocyte transcription factor 1
protein / nucleic acid binding / nuclease / Oligodendrocyte transcription factor 1
protein / nucleic acid binding / basic helix-loop-helix transcription factor / Oligodendrocyte transcription factor 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later