JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MSRB3

Description	Methionine-R-sulfoxide reductase B3

Gene and Protein Information

Gene ID	253827
Uniprot Accession IDs	Q8IXL7 B4DR19 B7ZAQ0 Q6UXS2 MsrB3
Ensembl ID	ENSG00000174099
Symbol	DFNB74
Chromosome	12
Family	Belongs to the MsrB Met sulfoxide reductase family.
Sequence	MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	744605	MSRB3	methionine sulfoxide reductase B3	9598	VGNC:13422	OMA, EggNOG
Macaque	717617	MSRB3	methionine sulfoxide reductase B3	9544		Inparanoid, OMA, EggNOG
Mouse	320183	Msrb3	methionine sulfoxide reductase B3	10090	MGI:2443538	Inparanoid, OMA, EggNOG
Rat	680036	Msrb3	methionine sulfoxide reductase B3	10116	RGD:1596851	OMA, EggNOG
Dog	608386	MSRB3	methionine sulfoxide reductase B3	9615	VGNC:43451	Inparanoid, OMA, EggNOG
Horse		MSRB3	methionine sulfoxide reductase B3 [Source:HGNC Symbol;Acc:HGNC:27375]	9796		OMA, EggNOG
Cow	617849	MSRB3	methionine sulfoxide reductase B3	9913	VGNC:54457	Inparanoid, OMA, EggNOG
Pig	100511693	MSRB3	methionine sulfoxide reductase B3	9823		OMA, EggNOG
Platypus	100079557	MSRB3	methionine sulfoxide reductase B3	9258		OMA, EggNOG
Chicken	417833	MSRB3	methionine sulfoxide reductase B3	9031	CGNC:13069	Inparanoid, OMA
Anole lizard	100553315	msrb3	methionine sulfoxide reductase B3	28377		Inparanoid, OMA, EggNOG
Zebrafish	415184	msrb3	methionine sulfoxide reductase B3	7955	ZDB-GENE-040625-74	Inparanoid, OMA, EggNOG
Fruitfly	41309	SelR	Selenoprotein R	7227	FBgn0267376	Inparanoid, EggNOG
S.cerevisiae	850324	MXR2	Mxr2p	4932	S000000538	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.