JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

DKK1

Description	Dickkopf-related protein 1

Gene and Protein Information

Gene ID	22943
Uniprot Accession IDs	O94907 B2RC19 Dickkopf-1
Ensembl ID	ENSG00000107984
Symbol	SK DKK-1
Chromosome	10
Family	Belongs to the dickkopf family.
Sequence	MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	450465	DKK1	dickkopf WNT signaling pathway inhibitor 1	9598	VGNC:1625	OMA, EggNOG
Macaque	702997	DKK1	dickkopf WNT signaling pathway inhibitor 1	9544		Inparanoid, OMA, EggNOG
Mouse	13380	Dkk1	dickkopf WNT signaling pathway inhibitor 1	10090	MGI:1329040	Inparanoid, OMA, EggNOG
Rat	293897	Dkk1	dickkopf WNT signaling pathway inhibitor 1	10116	RGD:1307313	Inparanoid, OMA
Dog	609600	DKK1	dickkopf WNT signaling pathway inhibitor 1	9615	VGNC:52929	Inparanoid, OMA
Horse	100071881	DKK1	dickkopf WNT signaling pathway inhibitor 1	9796	VGNC:51486	Inparanoid, OMA
Cow	504445	DKK1	dickkopf WNT signaling pathway inhibitor 1	9913	VGNC:28079	Inparanoid, OMA, EggNOG
Pig	100157640	DKK1	dickkopf WNT signaling pathway inhibitor 1	9823		Inparanoid, OMA, EggNOG
Platypus	100073484	DKK1	dickkopf WNT signaling pathway inhibitor 1	9258		Inparanoid, OMA
Xenopus	549037	dkk1	dickkopf WNT signaling pathway inhibitor 1	8364	XB-GENE-481644	Inparanoid, OMA, EggNOG
Zebrafish	30197	dkk1b	dickkopf WNT signaling pathway inhibitor 1b	7955	ZDB-GENE-990708-5	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.