JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MBNL1

Description	Muscleblind-like protein 1

Gene and Protein Information

Gene ID	4154
Uniprot Accession IDs	Q9NR56 E9PBW7 O43311 O43797 Q86UV8 Q86UV9 Q96P92 Q96RE3
Ensembl ID	ENSG00000152601
Symbol	EXP KIAA0428 MBNL EXP MBNL
Chromosome	3
Family	Belongs to the muscleblind family.
Sequence	MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	460787	MBNL1	muscleblind like splicing regulator 1	9598	VGNC:2039	OMA, EggNOG
Macaque	708735	MBNL1	muscleblind like splicing regulator 1	9544		Inparanoid, OMA, EggNOG
Mouse	56758	Mbnl1	muscleblind like splicing factor 1	10090	MGI:1928482	Inparanoid, OMA, EggNOG
Rat	282635	Mbnl1	muscleblind-like splicing regulator 1	10116	RGD:628668	Inparanoid, OMA, EggNOG
Dog	477116	MBNL1	muscleblind like splicing regulator 1	9615	VGNC:43057	Inparanoid, OMA, EggNOG
Horse	100050018	MBNL1	muscleblind like splicing regulator 1	9796	VGNC:20014	Inparanoid, OMA, EggNOG
Cow	781653	MBNL1	muscleblind like splicing regulator 1	9913	VGNC:31283	Inparanoid, OMA, EggNOG
Pig	100525306	MBNL1	muscleblind like splicing regulator 1	9823		Inparanoid, OMA, EggNOG
Opossum	100012831	MBNL1	muscleblind like splicing regulator 1	13616		Inparanoid, OMA, EggNOG
Platypus		MBNL1	muscleblind like splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:6923]	9258		OMA, EggNOG
Xenopus		mbnl1	muscleblind like splicing regulator 1 [Source:Xenbase;Acc:XB-GENE-6035557]	8364		OMA, EggNOG

PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Muscleblind-like protein 1

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Muscleblind-like protein 1

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.