JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MBD2

Description	Methyl-CpG-binding domain protein 2

Gene and Protein Information

Gene ID	8932
Uniprot Accession IDs	Q9UBB5 O95242 Q9UIS8
Ensembl ID	ENSG00000134046
Symbol	DMTase NY-CO-41
Chromosome	18
Sequence	MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	693801	MBD2	methyl-CpG binding domain protein 2	9544		Inparanoid, OMA
Mouse	17191	Mbd2	methyl-CpG binding domain protein 2	10090	MGI:1333813	Inparanoid, OMA, EggNOG
Rat	680172	Mbd2	methyl-CpG binding domain protein 2	10116	RGD:1595452	Inparanoid, OMA, EggNOG
Horse	100070096	MBD2	methyl-CpG binding domain protein 2	9796	VGNC:20006	Inparanoid, OMA, EggNOG
Pig	100511112	MBD2	methyl-CpG binding domain protein 2	9823		OMA, EggNOG
Opossum	100009966	MBD2	methyl-CpG binding domain protein 2	13616		Inparanoid, OMA, EggNOG
Xenopus	100216281	mbd2	methyl-CpG binding domain protein 2	8364	XB-GENE-493776	Inparanoid, EggNOG

DTO Classes
protein / Epigenetic regulator / Reader / Methyl-CpG-binding domain / Methyl-CpG-binding domain protein 2

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.