This is a demo store. No orders will be fulfilled.

SELE

Description E-selectin

Gene and Protein Information

Gene ID 6401
Uniprot Accession IDs P16581 A2RRD6 P16111
Ensembl ID ENSG00000007908
Symbol ELAM1 ELAM ESEL CD62E ELAM1 LECAM2
Chromosome 1
Family Belongs to the selectin/LECAM family.
Sequence
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 736063 SELE selectin E 9598 VGNC:1537 OMA, EggNOG
Macaque 701538 SELE selectin E 9544 Inparanoid, OMA, EggNOG
Mouse 20339 Sele selectin, endothelial cell 10090 MGI:98278 Inparanoid, OMA, EggNOG
Rat 25544 Sele selectin E 10116 RGD:3654 Inparanoid, OMA, EggNOG
Dog 403999 SELE selectin E 9615 VGNC:45980 Inparanoid, OMA, EggNOG
Horse 100033910 SELE selectin E 9796 VGNC:50882 Inparanoid, OMA, EggNOG
Cow 281484 SELE selectin E 9913 VGNC:34421 Inparanoid, OMA, EggNOG
Pig 397508 SELE selectin E 9823 Inparanoid, OMA, EggNOG
Platypus 103170505 SELE selectin E 9258 Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.