Il s'agit d'un magasin de démonstration. Aucune commande ne sera honorée.

IGLV1-51

Description Immunoglobulin lambda variable 1-51

Gene and Protein Information

Gene ID 28820
Uniprot Accession IDs P01701 A0A075B6I5 P01702 P06316 P06888
Symbole V1-19 IGLV151
Chromosome 22
Sequence
MTCSPLLLTLLIHCTGSWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA

Protein Classes

PANTHER Classes
protein    /    defense/immunity protein    /    immunoglobulin    /    Immunoglobulin lambda variable 1-51
DTO Classes
protein    /    Immune response    /    Immunoglobulin    /    Immunoglobulin lambda variable 1-51

Associated Recombinant Proteins

Nom Specification and purity Expression system Protein label Disponibilité Voir les détails

Associated Antibodies

Nom Specifications Species reactivity Application Disponibilité Voir les détails

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nom Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.