This is a demo store. No orders will be fulfilled.
| Description | U6 snRNA-associated Sm-like protein LSm1 |
|---|
Gene and Protein Information
| Gene ID | 27257 |
|---|---|
| Uniprot Accession IDs | O15116 B2R5E6 |
| Ensembl ID | ENSG00000175324 |
| Symbol | CASM CASM YJL124C |
| Chromosome | 8 |
| Family | Belongs to the snRNP Sm proteins family. |
| Sequence |
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746776 | LSM1 | LSM1 homolog, mRNA degradation associated | 9598 | VGNC:1168 | OMA, EggNOG |
| Mouse | 67207 | Lsm1 | LSM1 homolog, mRNA degradation associated | 10090 | MGI:1914457 | Inparanoid, OMA, EggNOG |
| Rat | 364624 | Lsm1 | LSM1 homolog, mRNA degradation associated | 10116 | RGD:1304967 | Inparanoid, OMA, EggNOG |
| Dog | 475587 | LSM1 | LSM1 homolog, mRNA degradation associated | 9615 | VGNC:42838 | Inparanoid, OMA, EggNOG |
| Horse | 100057784 | LSM1 | LSM1 homolog, mRNA degradation associated | 9796 | VGNC:19815 | Inparanoid, OMA, EggNOG |
| Cow | 535447 | LSM1 | LSM1 homolog, mRNA degradation associated | 9913 | VGNC:31050 | Inparanoid, OMA, EggNOG |
| Platypus | 103170245 | LSM1 | LSM1 homolog, mRNA degradation associated | 9258 | Inparanoid, EggNOG | |
| Chicken | 426775 | LSM1 | LSM1 homolog, mRNA degradation associated | 9031 | CGNC:2356 | OMA, EggNOG |
| Xenopus | 496613 | lsm1 | LSM1 homolog, mRNA degradation associated | 8364 | XB-GENE-971223 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445157 | lsm1 | LSM1, U6 small nuclear RNA associated | 7955 | ZDB-GENE-040801-68 | Inparanoid, OMA, EggNOG |
| C. elegans | 174700 | lsm-1 | LSM Sm-like protein | 6239 | Inparanoid, OMA | |
| Fruitfly | 37413 | LSm1 | Like Sm 1 | 7227 | FBgn0261067 | Inparanoid, EggNOG |
| S.cerevisiae | 853318 | LSM1 | Lsm1p | 4932 | S000003660 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / nuclease / U6 snRNA-associated Sm-like protein LSm1
protein / nucleic acid binding / mRNA splicing factor / U6 snRNA-associated Sm-like protein LSm1
protein / nucleic acid binding / nuclease / U6 snRNA-associated Sm-like protein LSm1
protein / nucleic acid binding / mRNA splicing factor / U6 snRNA-associated Sm-like protein LSm1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later