JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

GLO1

Description	Lactoylglutathione lyase

Gene and Protein Information

Gene ID	2739
Uniprot Accession IDs	Q04760 B2R6P7 B4DDV0 P78375 Q59EL0 Q5TZW3 Q96FC0 Q96J41
Ensembl ID	ENSG00000124767
Symbol	GLYI GLOD1 HEL-S-74
Chromosome	6
Family	Belongs to the glyoxalase I family.
Sequence	MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	748215	GLO1	glyoxalase I	9598	VGNC:2843	OMA, EggNOG
Mouse	109801	Glo1	glyoxalase 1	10090	MGI:95742	Inparanoid, OMA, EggNOG
Rat	294320	Glo1	glyoxalase 1	10116	RGD:2702	Inparanoid, OMA, EggNOG
Dog	474894	GLO1	glyoxalase I	9615		Inparanoid, OMA, EggNOG
Horse	100065189	GLO1	glyoxalase I	9796	VGNC:49457	Inparanoid, OMA, EggNOG
Cow	540335	GLO1	glyoxalase I	9913	VGNC:50185	Inparanoid, OMA, EggNOG
Pig	100156085	GLO1	glyoxalase I	9823		Inparanoid, OMA, EggNOG
Opossum	100029700	GLO1	glyoxalase I	13616		Inparanoid, OMA, EggNOG
Platypus	100076218	GLO1	glyoxalase I	9258		Inparanoid, OMA, EggNOG
Chicken	421428	GLO1	glyoxalase I	9031	CGNC:7697	Inparanoid, OMA, EggNOG
Anole lizard	100567895	glo1	glyoxalase I	28377		Inparanoid, OMA, EggNOG
Xenopus	594942	glo1	glyoxalase 1	8364	XB-GENE-995333	Inparanoid, OMA
Zebrafish	368213	glo1	glyoxalase 1	7955	ZDB-GENE-030722-9	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.