The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
LEF1
| Description |
Lymphoid enhancer-binding factor 1
|
Gene and Protein Information
| Gene ID |
51176
|
| Uniprot Accession IDs |
Q9UJU2
B4DG38
B7Z8E2
E9PDK3
Q3ZCU4
Q9HAZ0
LEF-1
|
| Ensembl ID |
ENSG00000138795
|
| Symbol |
LEF-1
TCF10
TCF7L3
TCF1ALPHA
|
| Chromosome |
4
|
| Family |
Belongs to the TCF/LEF family. |
| Sequence |
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
461425 |
LEF1 |
lymphoid enhancer binding factor 1 |
9598 |
VGNC:6477 |
OMA, EggNOG |
| Macaque |
695776 |
LEF1 |
lymphoid enhancer binding factor 1 |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
16842 |
Lef1 |
lymphoid enhancer binding factor 1 |
10090 |
MGI:96770 |
Inparanoid, OMA, EggNOG |
| Rat |
161452 |
Lef1 |
lymphoid enhancer binding factor 1 |
10116 |
RGD:620241 |
Inparanoid, OMA, EggNOG |
| Dog |
478507 |
LEF1 |
lymphoid enhancer binding factor 1 |
9615 |
VGNC:42630 |
Inparanoid, OMA, EggNOG |
| Horse |
100072938 |
LEF1 |
lymphoid enhancer binding factor 1 |
9796 |
VGNC:19627 |
Inparanoid, OMA, EggNOG |
| Cow |
535399 |
LEF1 |
lymphoid enhancer binding factor 1 |
9913 |
VGNC:30833 |
Inparanoid, OMA, EggNOG |
| Pig |
100170126 |
LEF1 |
lymphoid enhancer binding factor 1 |
9823 |
|
Inparanoid, OMA, EggNOG |
| Opossum |
100011783 |
LEF1 |
lymphoid enhancer binding factor 1 |
13616 |
|
Inparanoid, OMA, EggNOG |
| Anole lizard |
100556215 |
lef1 |
lymphoid enhancer binding factor 1 |
28377 |
|
Inparanoid, OMA, EggNOG |
| Xenopus |
100493178 |
lef1 |
lymphoid enhancer binding factor 1 |
8364 |
XB-GENE-485517 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
30701 |
lef1 |
lymphoid enhancer-binding factor 1 |
7955 |
ZDB-GENE-990714-26 |
Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.