JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Account

Settings

Language

྾

Home
Targets(Human)
MAPRE3

MAPRE3

Description	Microtubule-associated protein RP/EB family member 3

Gene and Protein Information

Gene ID	22924
Uniprot Accession IDs	Q9UPY8 B7WPK5 O00265 Q6FHB0 Q6FI15 Q9BZP7 Q9BZP8
Ensembl ID	ENSG00000084764
Symbol	EB3 RP3 EBF3 EBF3-S
Chromosome	2
Family	Belongs to the MAPRE family.
Sequence	MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	106992881	MAPRE3	microtubule associated protein RP/EB family member 3	9544		Inparanoid, OMA, EggNOG
Mouse	100732	Mapre3	microtubule-associated protein, RP/EB family, member 3	10090	MGI:2140967	Inparanoid, OMA, EggNOG
Rat	298848	Mapre3	microtubule-associated protein, RP/EB family, member 3	10116	RGD:1359297	Inparanoid, OMA, EggNOG
Dog	475694	MAPRE3	microtubule associated protein RP/EB family member 3	9615	VGNC:43011	Inparanoid, OMA, EggNOG
Horse	100629914	MAPRE3	microtubule associated protein RP/EB family member 3	9796		OMA, EggNOG
Horse	100050599	LOC100050599	microtubule-associated protein RP/EB family member 3	9796		Inparanoid, OMA
Cow	528839	MAPRE3	microtubule associated protein RP/EB family member 3	9913	VGNC:31234	Inparanoid, OMA, EggNOG
Pig	100524857	MAPRE3	microtubule associated protein RP/EB family member 3	9823		OMA, EggNOG
Opossum	100618640	MAPRE3	microtubule associated protein RP/EB family member 3	13616		Inparanoid, EggNOG
Anole lizard	100559494	mapre3	microtubule associated protein RP/EB family member 3	28377		Inparanoid, OMA
Zebrafish	431717	mapre3b	microtubule-associated protein, RP/EB family, member 3b	7955	ZDB-GENE-040704-6	Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 3

DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated protein RP/EB family member 3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.