JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

LMO4

Description	LIM domain transcription factor LMO4

Gene and Protein Information

Gene ID	8543
Uniprot Accession IDs	P61968 D3DT23 O00158 O88894
Ensembl ID	ENSG00000143013
Chromosome	1
Sequence	MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	737619	LMO4	LIM domain only 4	9598	VGNC:11517	OMA, EggNOG
Macaque	712752	LMO4	LIM domain only 4	9544		Inparanoid, OMA, EggNOG
Mouse	16911	Lmo4	LIM domain only 4	10090	MGI:109360	Inparanoid, OMA, EggNOG
Rat	362051	Lmo4	LIM domain only 4	10116	RGD:1305670	Inparanoid, OMA
Dog	479962	LMO4	LIM domain only 4	9615	VGNC:42724	Inparanoid, OMA, EggNOG
Horse	100052327	LMO4	LIM domain only 4	9796	VGNC:19711	Inparanoid, OMA, EggNOG
Cow	614212	LMO4	LIM domain only 4	9913	VGNC:30936	Inparanoid, OMA, EggNOG
Pig	100127155	LMO4	LIM domain only 4	9823		Inparanoid, OMA, EggNOG
Opossum	100010796	LMO4	LIM domain only 4	13616		Inparanoid, OMA, EggNOG
Platypus	100075084	LMO4	LIM domain only 4	9258		Inparanoid, OMA, EggNOG
Chicken	373901	LMO4	LIM domain only 4	9031	CGNC:48949	Inparanoid, OMA, EggNOG
Xenopus	448304	lmo4.1	LIM domain only 4, gene 1	8364	XB-GENE-971939	Inparanoid, OMA, EggNOG
Zebrafish	324849	lmo4b	LIM domain only 4b	7955	ZDB-GENE-030131-3570	Inparanoid, OMA, EggNOG
Fruitfly	34361	CG5708	CG5708 gene product from transcript CG5708-RC	7227	FBgn0032196	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.