JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

LAMTOR5

Description	Ragulator complex protein LAMTOR5

Gene and Protein Information

Gene ID	10542
Uniprot Accession IDs	O43504 Q6IBD8
Ensembl ID	ENSG00000134248
Symbol	HBXIP XIP XIP HBXIP
Chromosome	1
Family	Belongs to the LAMTOR5 family.
Sequence	MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	457120	LAMTOR5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	9598	VGNC:8351	OMA, EggNOG
Mouse	68576	Lamtor5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	10090	MGI:1915826	Inparanoid, EggNOG
Rat	295357	Lamtor5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	10116	RGD:1305005	Inparanoid, EggNOG
Horse	106783217	LAMTOR5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	9796	VGNC:19577	Inparanoid, OMA, EggNOG
Cow	516090	LAMTOR5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	9913		Inparanoid, OMA, EggNOG
Opossum	100033089	LAMTOR5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	13616		Inparanoid, OMA, EggNOG
Chicken	419811	LAMTOR5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	9031	CGNC:250	OMA, EggNOG
Anole lizard	100564514	lamtor5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	28377		Inparanoid, OMA, EggNOG
Xenopus	100135168	lamtor5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	8364	XB-GENE-950195	Inparanoid, OMA, EggNOG
Zebrafish	100333504	lamtor5	late endosomal/lysosomal adaptor, MAPK and MTOR activator 5	7955	ZDB-GENE-110411-193	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.