JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CD58

Description	Lymphocyte function-associated antigen 3

Gene and Protein Information

Gene ID	965
Uniprot Accession IDs	P19256 A8K7G5 Q5U053 Q6IB65 Q96KI9 Ag3
Ensembl ID	ENSG00000116815
Symbol	LFA3 ag3 LFA3 LFA-3
Chromosome	1
Sequence	MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	457154	CD58	CD58 molecule	9598	VGNC:5014	OMA, EggNOG
Macaque	710732	CD58	CD58 molecule	9544		Inparanoid, OMA
Horse	100066062	CD58	CD58 molecule	9796	VGNC:50818	Inparanoid, OMA, EggNOG
Cow	782186	CD58	CD58 molecule	9913	VGNC:27040	Inparanoid, OMA, EggNOG
Pig	396702	CD58	CD58 molecule	9823		Inparanoid, OMA, EggNOG
Zebrafish	572028	si:dkey-11f4.14	si:dkey-11f4.14	7955	ZDB-GENE-070912-355	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.