This is a demo store. No orders will be fulfilled.
| Description | Myosin regulatory light chain 2, atrial isoform |
|---|
Gene and Protein Information
| Gene ID | 58498 |
|---|---|
| Uniprot Accession IDs | Q01449 B2R4L3 MLC-2a |
| Ensembl ID | ENSG00000106631 |
| Symbol | MYL2A MYLC2A MYL2A MYLC2A |
| Chromosome | 7 |
| Sequence |
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463920 | MYL7 | myosin light chain 7 | 9598 | VGNC:4439 | OMA, EggNOG |
| Macaque | 707293 | MYL7 | myosin light chain 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17898 | Myl7 | myosin, light polypeptide 7, regulatory | 10090 | MGI:107495 | Inparanoid, OMA, EggNOG |
| Rat | 289759 | Myl7 | myosin light chain 7 | 10116 | RGD:1308262 | Inparanoid, OMA |
| Horse | MYL7 | myosin light chain 7 [Source:HGNC Symbol;Acc:HGNC:21719] | 9796 | OMA, EggNOG | ||
| Cow | 508257 | MYL7 | myosin light chain 7 | 9913 | VGNC:31804 | Inparanoid, OMA, EggNOG |
| Pig | GCK | Myosin regulatory light chain 2, atrial isoform [Source:UniProtKB/Swiss-Prot;Acc:F1SSF9] | 9823 | Inparanoid, EggNOG | ||
| Opossum | 100030115 | MYL7 | myosin light chain 7 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100091153 | MYL7 | myosin light chain 7 | 9258 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100135145 | myl7 | myosin light chain 7 | 8364 | XB-GENE-964041 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30592 | myl7 | myosin, light chain 7, regulatory | 7955 | ZDB-GENE-991019-3 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Myosin regulatory light chain 2, atrial isoform
protein / calcium-binding protein / actin family cytoskeletal protein / Myosin regulatory light chain 2, atrial isoform
protein / calcium-binding protein / calmodulin / Myosin regulatory light chain 2, atrial isoform
protein / calcium-binding protein / actin family cytoskeletal protein / Myosin regulatory light chain 2, atrial isoform
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Myosin regulatory light chain 2, atrial isoform
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Myosin regulatory light chain 2, atrial isoform
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later