JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MIEN1

Description	Migration and invasion enhancer 1

Gene and Protein Information

Gene ID	84299
Uniprot Accession IDs	Q9BRT3
Ensembl ID	ENSG00000141741
Symbol	C17orf37 RDX12 XTP4 C35 ORB3 XTP4 RDX12 C17orf37
Chromosome	17
Family	Belongs to the SelWTH family.
Sequence	MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746327	MIEN1	migration and invasion enhancer 1	9598	VGNC:9380	OMA, EggNOG
Mouse	103742	Mien1	migration and invasion enhancer 1	10090	MGI:1913678	Inparanoid, OMA, EggNOG
Rat	102552549	LOC102552549	migration and invasion enhancer 1-like	10116	RGD:7553401	OMA, EggNOG
Dog	480532	MIEN1	migration and invasion enhancer 1	9615	VGNC:43228	OMA, EggNOG
Horse	100054686	MIEN1	migration and invasion enhancer 1	9796	VGNC:20180	Inparanoid, OMA, EggNOG
Cow	505710	MIEN1	migration and invasion enhancer 1	9913	VGNC:31468	Inparanoid, OMA, EggNOG
Pig	100516461	MIEN1	migration and invasion enhancer 1	9823		OMA, EggNOG
Anole lizard	100566110	mien1	migration and invasion enhancer 1	28377		Inparanoid, OMA, EggNOG
Xenopus	548750	mien1	migration and invasion enhancer 1	8364	XB-GENE-969302	OMA, EggNOG
Zebrafish	378437	selenow2a	selenoprotein W, 2a	7955	ZDB-GENE-030428-1	OMA, EggNOG
Fruitfly	50123	CG15456	CG15456 gene product from transcript CG15456-RB	7227	FBgn0040650	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.