JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MBD3

Description	Methyl-CpG-binding domain protein 3

Gene and Protein Information

Gene ID	53615
Uniprot Accession IDs	O95983 A8K4B7 D6W5Z2 Q6PIL9 Q6PJZ9 Q86XF4
Ensembl ID	ENSG00000071655
Chromosome	19
Sequence	MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	455554	MBD3	methyl-CpG binding domain protein 3	9598	VGNC:6637	OMA, EggNOG
Macaque	708302	MBD3	methyl-CpG binding domain protein 3	9544		Inparanoid, OMA, EggNOG
Mouse	17192	Mbd3	methyl-CpG binding domain protein 3	10090	MGI:1333812	Inparanoid, OMA
Rat	362834	Mbd3	methyl-CpG binding domain protein 3	10116	RGD:1307389	Inparanoid, OMA
Dog	485080	MBD3	methyl-CpG binding domain protein 3	9615	VGNC:43050	Inparanoid, OMA
Opossum	100013381	MBD3	methyl-CpG binding domain protein 3	13616		Inparanoid, OMA
Platypus	100076323	MBD3	methyl-CpG binding domain protein 3	9258		Inparanoid, OMA
Chicken	770153	MBD3	methyl-CpG binding domain protein 3	9031	CGNC:55815	Inparanoid, OMA
Xenopus	448748	mbd3	methyl-CpG binding domain protein 3	8364	XB-GENE-491553	Inparanoid, OMA, EggNOG
Zebrafish	337133	mbd3a	methyl-CpG binding domain protein 3a	7955	ZDB-GENE-030131-9077	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.