JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

EEF1E1

Description	Eukaryotic translation elongation factor 1 epsilon-1

Gene and Protein Information

Gene ID	9521
Uniprot Accession IDs	O43324 C9JLK5 Q5THS2
Ensembl ID	ENSG00000124802
Symbol	AIMP3 P18 P18 AIMP3
Chromosome	6
Sequence	MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462423	EEF1E1	eukaryotic translation elongation factor 1 epsilon 1	9598		OMA, EggNOG
Macaque	695426	EEF1E1	eukaryotic translation elongation factor 1 epsilon 1	9544		Inparanoid, OMA, EggNOG
Mouse	66143	Eef1e1	eukaryotic translation elongation factor 1 epsilon 1	10090	MGI:1913393	Inparanoid, OMA, EggNOG
Rat	291057	Eef1e1	eukaryotic translation elongation factor 1 epsilon 1	10116	RGD:1311056	Inparanoid, OMA, EggNOG
Dog	478717	EEF1E1	eukaryotic translation elongation factor 1 epsilon 1	9615		Inparanoid, OMA
Cow	617105	EEF1E1	eukaryotic translation elongation factor 1 epsilon 1	9913		Inparanoid, OMA
Chicken	420865	EEF1E1	eukaryotic translation elongation factor 1 epsilon 1	9031	CGNC:9688	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.