JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MGMT

Description	Methylated-DNA--protein-cysteine methyltransferase

Gene and Protein Information

Gene ID	4255
Uniprot Accession IDs	P16455 Q5VY78
Ensembl ID	ENSG00000170430
Chromosome	10
Family	Belongs to the MGMT family.
Sequence	MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	737624	MGMT	O-6-methylguanine-DNA methyltransferase	9598	VGNC:7280	OMA, EggNOG
Macaque	698134	MGMT	O-6-methylguanine-DNA methyltransferase	9544		Inparanoid, OMA, EggNOG
Mouse	17314	Mgmt	O-6-methylguanine-DNA methyltransferase	10090	MGI:96977	Inparanoid, OMA, EggNOG
Rat	25332	Mgmt	O-6-methylguanine-DNA methyltransferase	10116	RGD:3087	Inparanoid, OMA, EggNOG
Dog	442978	MGMT	O-6-methylguanine-DNA methyltransferase	9615	VGNC:43213	Inparanoid, OMA, EggNOG
Horse	100049801	MGMT	O-6-methylguanine-DNA methyltransferase	9796	VGNC:20163	Inparanoid, OMA, EggNOG
Pig	100155050	MGMT	O-6-methylguanine-DNA methyltransferase	9823		Inparanoid, OMA, EggNOG
Anole lizard	100553369	mgmt	O-6-methylguanine-DNA methyltransferase	28377		Inparanoid, EggNOG
Xenopus	496878	mgmt	O-6-methylguanine-DNA methyltransferase	8364	XB-GENE-941688	Inparanoid, OMA, EggNOG
Zebrafish	553368	mgmt	O-6-methylguanine-DNA methyltransferase	7955	ZDB-GENE-120614-1	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.