JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MMAB

Description	Corrinoid adenosyltransferase

Gene and Protein Information

Gene ID	326625
Uniprot Accession IDs	Q96EY8 C5HU05 Q9BSH0
Ensembl ID	ENSG00000139428
Symbol	ATR cob cblB CFAP23
Chromosome	12
Family	Belongs to the Cob(I)alamin adenosyltransferase family.
Sequence	MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	452403	MMAB	methylmalonic aciduria (cobalamin deficiency) cblB type	9598		OMA, EggNOG
Macaque	708973	MMAB	methylmalonic aciduria (cobalamin deficiency) cblB type	9544		Inparanoid, OMA
Mouse	77697	Mmab	methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human)	10090	MGI:1924947	Inparanoid, OMA, EggNOG
Rat	687861	Mmab	methylmalonic aciduria (cobalamin deficiency) cblB type	10116	RGD:1596242	Inparanoid, OMA
Dog	486310	MMAB	methylmalonic aciduria (cobalamin deficiency) cblB type	9615		Inparanoid, OMA, EggNOG
Horse	100066641	MMAB	methylmalonic aciduria (cobalamin deficiency) cblB type	9796		Inparanoid, OMA, EggNOG
Cow	617636	MMAB	methylmalonic aciduria (cobalamin deficiency) cblB type	9913		Inparanoid, OMA, EggNOG
Pig	100157459	MMAB	methylmalonic aciduria (cobalamin deficiency) cblB type	9823		Inparanoid, OMA, EggNOG
Opossum	100028469	MMAB	methylmalonic aciduria (cobalamin deficiency) cblB type	13616		Inparanoid, OMA, EggNOG
Zebrafish	557077	mmab	methylmalonic aciduria (cobalamin deficiency) cblB type	7955	ZDB-GENE-060526-232	Inparanoid, OMA, EggNOG
C. elegans	175661	mmab-1	MethylMalonic Aciduria type B homolog	6239		Inparanoid, OMA

PANTHER Classes
protein / oxidoreductase / dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial

DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.