JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MIF

Description	Macrophage migration inhibitory factor

Gene and Protein Information

Gene ID	4282
Uniprot Accession IDs	P14174 A5Z1R8 B2R4S3 Q2V4Y5 Q6FHV0 MIF
Ensembl ID	ENSG00000240972
Symbol	GLIF MMIF GIF GLIF MMIF
Chromosome	22
Family	Belongs to the MIF family.
Sequence	MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque		MIF	Macrophage migration inhibitory factor [Source:UniProtKB/Swiss-Prot;Acc:Q6DN04]	9544		Inparanoid, EggNOG
Mouse	17319	Mif	macrophage migration inhibitory factor (glycosylation-inhibiting factor)	10090	MGI:96982	Inparanoid, OMA, EggNOG
Rat		AC127887.1	-	10116		OMA, EggNOG
Horse	100053618	MIF	macrophage migration inhibitory factor	9796	VGNC:50485	Inparanoid, OMA, EggNOG
Cow	280858	MIF	macrophage migration inhibitory factor	9913	VGNC:49557	Inparanoid, OMA, EggNOG
Pig	397412	MIF	macrophage migration inhibitory factor	9823		Inparanoid, OMA, EggNOG
Opossum		MIF	macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097]	13616		Inparanoid, OMA, EggNOG
Platypus		MIF	macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097]	9258		OMA, EggNOG
Chicken	100857237	MIF	macrophage migration inhibitory factor (glycosylation-inhibiting factor)	9031	CGNC:65768	Inparanoid, OMA, EggNOG
Xenopus		MIF	macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097]	8364		OMA, EggNOG
Zebrafish	751093	mif	macrophage migration inhibitory factor	7955	ZDB-GENE-080708-1	Inparanoid, OMA, EggNOG
C. elegans	176615	mif-1	MIF (Macrophage migration Inhibitory Factor) related	6239		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.