JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MED19

Description	Mediator of RNA polymerase II transcription subunit 19

Gene and Protein Information

Gene ID	219541
Uniprot Accession IDs	A0JLT2 Q8IV02 Q8IZD1
Ensembl ID	ENSG00000156603
Symbol	LCMR1 LCMR1 DT2P1G7 MED19AS
Chromosome	11
Family	Belongs to the Mediator complex subunit 19 family.
Sequence	MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	451200	MED19	mediator complex subunit 19	9598	VGNC:53068	OMA, EggNOG
Macaque	704421	MED19	mediator complex subunit 19	9544		Inparanoid, OMA, EggNOG
Mouse	381379	Med19	mediator complex subunit 19	10090	MGI:1914234	Inparanoid, OMA, EggNOG
Rat	311165	Med19	mediator complex subunit 19	10116	RGD:1311926	Inparanoid, OMA, EggNOG
Dog	612925	MED19	mediator complex subunit 19	9615	VGNC:43128	Inparanoid, OMA, EggNOG
Horse	100066998	MED19	mediator complex subunit 19	9796	VGNC:20077	Inparanoid, OMA, EggNOG
Cow	509245	MED19	mediator complex subunit 19	9913	VGNC:31356	Inparanoid, OMA, EggNOG
Pig	100520359	MED19	mediator complex subunit 19	9823		OMA, EggNOG
Opossum	100022927	MED19	mediator complex subunit 19	13616		OMA, EggNOG
Chicken	428854	MED19	mediator complex subunit 19	9031	CGNC:5547	Inparanoid, OMA, EggNOG
Anole lizard	100556094	med19	mediator complex subunit 19	28377		Inparanoid, OMA, EggNOG
Xenopus		MED19	mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600]	8364		OMA, EggNOG
Zebrafish	445021	med19b	mediator complex subunit 19b	7955	ZDB-GENE-040727-4	OMA, EggNOG
C. elegans	175378	mdt-19	Mediator of RNA polymerase II transcription subunit 19	6239		Inparanoid, OMA, EggNOG
Fruitfly	39987	MED19	Mediator complex subunit 19	7227	FBgn0036761	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.