JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MAD2L2

Description	Mitotic spindle assembly checkpoint protein MAD2B

Gene and Protein Information

Gene ID	10459
Uniprot Accession IDs	Q9UI95 B3KNE3 Q5TGW7 Q9UNA7 Q9Y6I6
Ensembl ID	ENSG00000116670
Symbol	MAD2B REV7 REV7 FANCV MAD2B POLZ2
Chromosome	1
Sequence	MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	457953	MAD2L2	mitotic arrest deficient 2 like 2	9598	VGNC:14802	OMA, EggNOG
Macaque	714527	MAD2L2	mitotic arrest deficient 2 like 2	9544		Inparanoid, OMA
Mouse	71890	Mad2l2	MAD2 mitotic arrest deficient-like 2	10090	MGI:1919140	Inparanoid, OMA, EggNOG
Rat	313702	Mad2l2	mitotic arrest deficient 2 like 2	10116	RGD:1307499	Inparanoid, OMA
Dog	487443	MAD2L2	mitotic arrest deficient 2 like 2	9615	VGNC:52216	Inparanoid, OMA, EggNOG
Horse	100051122	MAD2L2	mitotic arrest deficient 2 like 2	9796	VGNC:19886	Inparanoid, OMA, EggNOG
Cow	506605	MAD2L2	mitotic arrest deficient 2 like 2	9913	VGNC:31132	Inparanoid, OMA, EggNOG
Pig	100736650	MAD2L2	mitotic arrest deficient 2 like 2	9823		OMA, EggNOG
Opossum		MAD2L2	mitotic arrest deficient 2 like 2 [Source:HGNC Symbol;Acc:HGNC:6764]	13616		Inparanoid, OMA, EggNOG
Chicken	419493	MAD2L2	MAD2 mitotic arrest deficient-like 2 (yeast)	9031	CGNC:3434	Inparanoid, OMA, EggNOG
Xenopus	448122	mad2l2	mitotic arrest deficient 2 like 2	8364	XB-GENE-973653	Inparanoid, OMA, EggNOG
Zebrafish	550258	si:dkey-23c22.2	si:dkey-23c22.2	7955	ZDB-GENE-081105-11	Inparanoid, OMA
Fruitfly	40677	rev7	CG2948 gene product from transcript CG2948-RA	7227	FBgn0037345	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.