JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

MAD2L1

Description	Mitotic spindle assembly checkpoint protein MAD2A

Gene and Protein Information

Gene ID	4085
Uniprot Accession IDs	Q13257 Q53F56 Q548X9 Q6IRW7 Q8IZX3 HsMAD2
Ensembl ID	ENSG00000164109
Symbol	MAD2 MAD2 HSMAD2
Chromosome	4
Family	Belongs to the MAD2 family.
Sequence	MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	461661	MAD2L1	mitotic arrest deficient 2 like 1	9598	VGNC:48884	OMA, EggNOG
Mouse	56150	Mad2l1	MAD2 mitotic arrest deficient-like 1	10090	MGI:1860374	Inparanoid, OMA, EggNOG
Rat	297176	Mad2l1	mitotic arrest deficient 2 like 1	10116	RGD:1310889	Inparanoid, OMA, EggNOG
Dog	476070	MAD2L1	mitotic arrest deficient 2 like 1	9615		Inparanoid, OMA, EggNOG
Horse	100072353	MAD2L1	mitotic arrest deficient 2 like 1	9796	VGNC:19884	Inparanoid, OMA, EggNOG
Cow	337870	MAD2L1	MAD2 mitotic arrest deficient-like 1 (yeast)	9913		Inparanoid, OMA, EggNOG
Opossum	100018245	MAD2L1	mitotic arrest deficient 2 like 1	13616		Inparanoid, OMA, EggNOG
Platypus	100081525	MAD2L1	mitotic arrest deficient 2 like 1	9258		OMA, EggNOG
Chicken	422675	MAD2L1	MAD2 mitotic arrest deficient-like 1 (yeast)	9031	CGNC:51801	Inparanoid, OMA, EggNOG
Anole lizard	100566557	mad2l1	mitotic arrest deficient 2 like 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100125170	mad2l1	mitotic arrest deficient 2 like 1	8364	XB-GENE-947153	Inparanoid, OMA, EggNOG
Zebrafish	550434	mad2l1	MAD2 mitotic arrest deficient-like 1 (yeast)	7955	ZDB-GENE-030515-3	Inparanoid, OMA, EggNOG
C. elegans	177046	mdf-2	MAD (yeast Mitosis arrest DeFicient) related	6239		Inparanoid, OMA
Fruitfly	38656	mad2	CG17498 gene product from transcript CG17498-RA	7227	FBgn0035640	Inparanoid, EggNOG
S.cerevisiae	853422	MAD2	spindle checkpoint protein MAD2	4932	S000003567	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.