The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
NEDD8
Gene and Protein Information
| Gene ID |
4738
|
| Uniprot Accession IDs |
Q15843
Q3SXN8
Q6LES6
|
| Ensembl ID |
ENSG00000129559
|
| Symbol |
NEDD-8
|
| Chromosome |
14
|
| Family |
Belongs to the ubiquitin family. |
| Sequence |
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Macaque |
|
NEDD8 |
magnesium dependent phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:28781] |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
18002 |
Nedd8 |
neural precursor cell expressed, developmentally down-regulated gene 8 |
10090 |
MGI:97301 |
Inparanoid, OMA, EggNOG |
| Rat |
25490 |
Nedd8 |
neural precursor cell expressed, developmentally down-regulated 8 |
10116 |
RGD:3158 |
Inparanoid, OMA, EggNOG |
| Dog |
480265 |
NEDD8 |
neural precursor cell expressed, developmentally down-regulated 8 |
9615 |
|
Inparanoid, OMA, EggNOG |
| Horse |
100051307 |
NEDD8 |
neural precursor cell expressed, developmentally down-regulated 8 |
9796 |
|
Inparanoid, OMA, EggNOG |
| Cow |
286796 |
NEDD8 |
neural precursor cell expressed, developmentally down-regulated 8 |
9913 |
|
Inparanoid, OMA, EggNOG |
| Opossum |
103101483 |
NEDD8 |
neural precursor cell expressed, developmentally down-regulated 8 |
13616 |
|
Inparanoid, EggNOG |
| Xenopus |
549727 |
nedd8 |
neural precursor cell expressed, developmentally down-regulated 8 |
8364 |
XB-GENE-6067551 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
368667 |
nedd8 |
neural precursor cell expressed, developmentally down-regulated 8 |
7955 |
ZDB-GENE-030616-588 |
Inparanoid, OMA, EggNOG |
| C. elegans |
172910 |
ned-8 |
NEDD8 |
6239 |
|
Inparanoid, OMA, EggNOG |
| Fruitfly |
35151 |
Nedd8 |
CG10679 gene product from transcript CG10679-RB |
7227 |
FBgn0032725 |
Inparanoid, EggNOG |
| S.cerevisiae |
851717 |
RUB1 |
NEDD8 family protein RUB1 |
4932 |
S000002546 |
OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.