JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

NEDD8

Description	NEDD8

Gene and Protein Information

Gene ID	4738
Uniprot Accession IDs	Q15843 Q3SXN8 Q6LES6
Ensembl ID	ENSG00000129559
Symbol	NEDD-8
Chromosome	14
Family	Belongs to the ubiquitin family.
Sequence	MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque		NEDD8	magnesium dependent phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:28781]	9544		Inparanoid, OMA, EggNOG
Mouse	18002	Nedd8	neural precursor cell expressed, developmentally down-regulated gene 8	10090	MGI:97301	Inparanoid, OMA, EggNOG
Rat	25490	Nedd8	neural precursor cell expressed, developmentally down-regulated 8	10116	RGD:3158	Inparanoid, OMA, EggNOG
Dog	480265	NEDD8	neural precursor cell expressed, developmentally down-regulated 8	9615		Inparanoid, OMA, EggNOG
Horse	100051307	NEDD8	neural precursor cell expressed, developmentally down-regulated 8	9796		Inparanoid, OMA, EggNOG
Cow	286796	NEDD8	neural precursor cell expressed, developmentally down-regulated 8	9913		Inparanoid, OMA, EggNOG
Opossum	103101483	NEDD8	neural precursor cell expressed, developmentally down-regulated 8	13616		Inparanoid, EggNOG
Xenopus	549727	nedd8	neural precursor cell expressed, developmentally down-regulated 8	8364	XB-GENE-6067551	Inparanoid, OMA, EggNOG
Zebrafish	368667	nedd8	neural precursor cell expressed, developmentally down-regulated 8	7955	ZDB-GENE-030616-588	Inparanoid, OMA, EggNOG
C. elegans	172910	ned-8	NEDD8	6239		Inparanoid, OMA, EggNOG
Fruitfly	35151	Nedd8	CG10679 gene product from transcript CG10679-RB	7227	FBgn0032725	Inparanoid, EggNOG
S.cerevisiae	851717	RUB1	NEDD8 family protein RUB1	4932	S000002546	OMA, EggNOG

PANTHER Classes
protein / nucleic acid binding / ribosomal protein / NEDD8

DTO Classes
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / NEDD8

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.