JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

LASP1

Description	LIM and SH3 domain protein 1

Gene and Protein Information

Gene ID	3927
Uniprot Accession IDs	Q14847 B4DGQ0 Q96ED2 Q96IG0 LASP-1
Ensembl ID	ENSG00000002834
Symbol	MLN50 MLN50 Lasp-1
Chromosome	17
Sequence	MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454620	LASP1	LIM and SH3 protein 1	9598	VGNC:9605	OMA, EggNOG
Macaque	694950	LASP1	LIM and SH3 protein 1	9544		Inparanoid, OMA, EggNOG
Mouse	16796	Lasp1	LIM and SH3 protein 1	10090	MGI:109656	Inparanoid, OMA, EggNOG
Rat	29278	Lasp1	LIM and SH3 protein 1	10116	RGD:68408	Inparanoid, OMA, EggNOG
Dog	608624	LASP1	LIM and SH3 protein 1	9615	VGNC:42595	Inparanoid, OMA, EggNOG
Horse	100068429	LASP1	LIM and SH3 protein 1	9796	VGNC:19594	Inparanoid, OMA, EggNOG
Cow	532851	LASP1	LIM and SH3 protein 1	9913	VGNC:30798	Inparanoid, OMA, EggNOG
Opossum	100018122	LASP1	LIM and SH3 protein 1	13616		Inparanoid, OMA, EggNOG
Anole lizard	100561573	lasp1	LIM and SH3 protein 1	28377		Inparanoid, OMA, EggNOG
Xenopus	493322	lasp1	LIM and SH3 protein 1	8364	XB-GENE-1008926	Inparanoid, OMA, EggNOG
Zebrafish	323216	lasp1	LIM and SH3 protein 1	7955	ZDB-GENE-030131-1936	Inparanoid, OMA
C. elegans	185685	F42H10.3	LIM and SH3 domain protein F42H10.3	6239		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.