JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

NIFK

Description	MKI67 FHA domain-interacting nucleolar phosphoprotein

Gene and Protein Information

Gene ID	84365
Uniprot Accession IDs	Q9BYG3 A8K788 Q8TB66 Q96ED4
Ensembl ID	ENSG00000155438
Symbol	MKI67IP NOPP34 Nopp34 MKI67IP
Chromosome	2
Sequence	MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459585	NIFK	nucleolar protein interacting with the FHA domain of MKI67	9598	VGNC:2712	OMA, EggNOG
Macaque	697198	NIFK	nucleolar protein interacting with the FHA domain of MKI67	9544		OMA, EggNOG
Mouse	67949	Nifk	nucleolar protein interacting with the FHA domain of MKI67	10090	MGI:1915199	Inparanoid, OMA, EggNOG
Rat	246042	Nifk	nucleolar protein interacting with the FHA domain of MKI67	10116	RGD:708462	Inparanoid, OMA, EggNOG
Dog	100856252	NIFK	nucleolar protein interacting with the FHA domain of MKI67	9615	VGNC:43809	OMA, EggNOG
Horse	100055172	NIFK	nucleolar protein interacting with the FHA domain of MKI67	9796	VGNC:51485	OMA, EggNOG
Cow	509598	NIFK	nucleolar protein interacting with the FHA domain of MKI67	9913	VGNC:32076	Inparanoid, OMA, EggNOG
Pig	100124386	NIFK	nucleolar protein interacting with the FHA domain of MKI67	9823		OMA, EggNOG
Opossum	100011091	NIFK	nucleolar protein interacting with the FHA domain of MKI67	13616		OMA, EggNOG
Chicken	424239	NIFK	nucleolar protein interacting with the FHA domain of MKI67	9031	CGNC:8852	OMA, EggNOG
Anole lizard	100564113	nifk	nucleolar protein interacting with the FHA domain of MKI67	28377		OMA, EggNOG
Zebrafish	317644	nifk	nucleolar protein interacting with the FHA domain of MKI67	7955	ZDB-GENE-021231-4	Inparanoid, OMA, EggNOG
Fruitfly	42662	CG6937	CG6937 gene product from transcript CG6937-RA	7227	FBgn0038989	Inparanoid, EggNOG
S.cerevisiae	855613	NOP15	rRNA-binding ribosome biosynthesis protein NOP15	4932	S000005054	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.