JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RASD2

Description	GTP-binding protein Rhes

Gene and Protein Information

Gene ID	23551
Uniprot Accession IDs	Q96D21 O95520 Q5THY8
Ensembl ID	ENSG00000100302
Symbol	TEM2 Rhes TEM2
Chromosome	22
Family	Belongs to the small GTPase superfamily. RasD family.
Sequence	MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	470196	RASD2	RASD family member 2	9598	VGNC:6018	OMA, EggNOG
Mouse	75141	Rasd2	RASD family, member 2	10090	MGI:1922391	Inparanoid, OMA, EggNOG
Rat	171099	Rasd2	RASD family, member 2	10116	RGD:628594	Inparanoid, OMA, EggNOG
Dog	481284	RASD2	RASD family member 2	9615	VGNC:45365	Inparanoid, OMA, EggNOG
Horse	100054386	RASD2	RASD family member 2	9796	VGNC:22194	Inparanoid, OMA, EggNOG
Cow	527921	RASD2	RASD family member 2	9913	VGNC:33741	Inparanoid, OMA, EggNOG
Opossum	100016530	RASD2	RASD family member 2	13616		Inparanoid, OMA, EggNOG
Platypus		RASD2	RASD family member 2 [Source:HGNC Symbol;Acc:HGNC:18229]	9258		OMA, EggNOG
Chicken	418057	RASD2	RASD family member 2	9031	CGNC:9520	Inparanoid, OMA
Anole lizard	100559661	rasd2	RASD family member 2	28377		Inparanoid, OMA
Xenopus	548760	rasd2	RASD family member 2	8364	XB-GENE-494969	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.