JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RGS4

Description	Regulator of G-protein signaling 4

Gene and Protein Information

Gene ID	5999
Uniprot Accession IDs	P49798 A7XA56 A7XA58 A7XA59 A7YVV7 B1APZ3 RGP4
Ensembl ID	ENSG00000117152
Symbol	RGP4 SCZD9
Chromosome	1
Sequence	MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	457470	RGS4	regulator of G protein signaling 4	9598	VGNC:8097	OMA, EggNOG
Macaque	693383	RGS4	regulator of G protein signaling 4	9544		Inparanoid, OMA, EggNOG
Mouse	19736	Rgs4	regulator of G-protein signaling 4	10090	MGI:108409	Inparanoid, OMA, EggNOG
Rat	29480	Rgs4	regulator of G-protein signaling 4	10116	RGD:3567	Inparanoid, OMA, EggNOG
Dog	488666	RGS4	regulator of G protein signaling 4	9615	VGNC:45534	Inparanoid, OMA, EggNOG
Horse	100058342	RGS4	regulator of G protein signaling 4	9796	VGNC:22353	Inparanoid, OMA, EggNOG
Cow	617437	RGS4	regulator of G protein signaling 4	9913	VGNC:54394	Inparanoid, OMA, EggNOG
Pig	100157437	RGS4	regulator of G protein signaling 4	9823		Inparanoid, OMA, EggNOG
Opossum	100012570	RGS4	regulator of G protein signaling 4	13616		Inparanoid, OMA, EggNOG
Chicken	378901	RGS4	regulator of G-protein signaling 4	9031	CGNC:49134	Inparanoid, OMA, EggNOG
Xenopus	394913	rgs4	regulator of G-protein signaling 4	8364	XB-GENE-942771	Inparanoid, OMA, EggNOG
Zebrafish	569876	rgs4	regulator of G protein signaling 4	7955	ZDB-GENE-030131-9839	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 4

DTO Classes
protein / Enzyme modulator / G-protein modulator / Regulator of G-protein signaling 4

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.