JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RGN

Description	Regucalcin

Gene and Protein Information

Gene ID	9104
Uniprot Accession IDs	Q15493 A4FTW1 A8K271 Q53FC9 Q5JRR5 RC
Ensembl ID	ENSG00000130988
Symbol	SMP30 RC GNL SMP30 HEL-S-41
Chromosome	X
Family	Belongs to the SMP-30/CGR1 family.
Sequence	MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	107970955	RGN	regucalcin	9598		Inparanoid, EggNOG
Macaque	705733	RGN	regucalcin	9544		Inparanoid, OMA, EggNOG
Mouse	19733	Rgn	regucalcin	10090	MGI:108024	Inparanoid, OMA, EggNOG
Rat	25106	Rgn	regucalcin	10116	RGD:3560	Inparanoid, OMA, EggNOG
Dog	480893	RGN	regucalcin	9615	VGNC:45516	Inparanoid, OMA, EggNOG
Horse	100060684	RGN	regucalcin	9796	VGNC:22336	OMA, EggNOG
Cow	280910	RGN	regucalcin	9913	VGNC:33907	Inparanoid, OMA, EggNOG
Pig	768107	RGN	regucalcin	9823		Inparanoid, OMA, EggNOG
Opossum	100010821	LOC100010821	regucalcin-like	13616		OMA, EggNOG
Chicken	395480	RGN	regucalcin	9031	CGNC:49339	Inparanoid, OMA
Anole lizard	100568168	rgn	regucalcin	28377		Inparanoid, OMA, EggNOG
Xenopus	448549	rgn	regucalcin	8364	XB-GENE-483637	Inparanoid, OMA, EggNOG
Zebrafish	403070	rgn	regucalcin	7955	ZDB-GENE-040718-68	Inparanoid, OMA
S.cerevisiae	852342	YBR053C	hypothetical protein	4932	S000000257	Inparanoid, EggNOG

PANTHER Classes
protein / hydrolase / esterase / Regucalcin
protein / hydrolase / calcium-binding protein / Regucalcin

DTO Classes
protein / Enzyme / Hydrolase / Esterase / Regucalcin

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.