JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RHOQ

Description	Rho-related GTP-binding protein RhoQ

Gene and Protein Information

Gene ID	23433
Uniprot Accession IDs	P17081 D6W5A6 Q0VGN1 Q52LS8 Q53SJ1 Q6NS39 Q6P146 Q7Z480
Ensembl ID	ENSG00000119729
Symbol	ARHQ RASL7A TC10 ARHQ TC10 TC10A RASL7A HEL-S-42
Chromosome	2
Family	Belongs to the small GTPase superfamily. Rho family.
Sequence	MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	717769	RHOQ	ras homolog family member Q	9544		OMA, EggNOG
Mouse	104215	Rhoq	ras homolog family member Q	10090	MGI:1931553	Inparanoid, OMA, EggNOG
Rat	85428	Rhoq	ras homolog family member Q	10116	RGD:621626	Inparanoid, OMA
Dog	474579	RHOQ	ras homolog family member Q	9615	VGNC:54538	OMA, EggNOG
Horse	100068479	RHOQ	ras homolog family member Q	9796	VGNC:51398	Inparanoid, OMA, EggNOG
Cow	100139988	RHOQ	ras homolog family member Q	9913	VGNC:33952	Inparanoid, OMA, EggNOG
Opossum	100032199	RHOQ	ras homolog family member Q	13616		Inparanoid, EggNOG
Chicken	395114	RHOQ	ras homolog family member Q	9031	CGNC:49176	Inparanoid, OMA
Anole lizard	100567122	rhoq	ras homolog family member Q	28377		Inparanoid, OMA
Zebrafish	327510	rhoq	ras homolog family member Q	7955	ZDB-GENE-030131-5721	Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / small GTPase / Rho-related GTP-binding protein RhoQ

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Rho-related GTP-binding protein RhoQ

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.