JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RHOC

Description	Rho-related GTP-binding protein RhoC

Gene and Protein Information

Gene ID	389
Uniprot Accession IDs	P08134 B3KSW1 Q6ICN3
Ensembl ID	ENSG00000155366
Symbol	ARH9 ARHC H9 ARH9 ARHC RHOH9
Chromosome	1
Family	Belongs to the small GTPase superfamily. Rho family.
Sequence	MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100612435	RHOC	ras homolog family member C	9598	VGNC:1493	OMA, EggNOG
Mouse	11853	Rhoc	ras homolog family member C	10090	MGI:106028	Inparanoid, OMA
Rat	295342	Rhoc	ras homolog family member C	10116	RGD:1304965	Inparanoid, OMA
Dog	483218	RHOC	ras homolog family member C	9615		Inparanoid, OMA
Horse	100146263	RHOC	ras homolog family member C	9796	VGNC:50866	Inparanoid, OMA
Cow	513152	RHOC	ras homolog family member C	9913		Inparanoid, OMA
Opossum	100619271	RHOC	ras homolog family member C	13616		Inparanoid, OMA
Chicken	395869	RHOC	ras homolog family member C	9031	CGNC:49521	Inparanoid, OMA
Anole lizard	100557494	rhoc	ras homolog family member C	28377		Inparanoid, OMA
C. elegans	178458	rho-1	Ras-like GTP-binding protein rhoA	6239		Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / small GTPase / Rho-related GTP-binding protein RhoC

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Rho-related GTP-binding protein RhoC

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.