This is a demo store. No orders will be fulfilled.
| Description | Dynein light chain 1, cytoplasmic |
|---|
Gene and Protein Information
| Gene ID | 8655 |
|---|---|
| Uniprot Accession IDs | P63167 Q15701 |
| Ensembl ID | ENSG00000088986 |
| Symbol | DLC1 DNCL1 DNCLC1 HDLC1 LC8 PIN DLC1 DLC8 LC8a DNCL1 hdlc1 DNCLC1 |
| Chromosome | 12 |
| Family | Belongs to the dynein light chain family. |
| Sequence |
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742676 | DYNLL1 | dynein light chain LC8-type 1 | 9598 | VGNC:13058 | OMA, EggNOG |
| Macaque | 702360 | DYNLL1 | dynein light chain LC8-type 1 | 9544 | Inparanoid, EggNOG | |
| Mouse | 56455 | Dynll1 | dynein light chain LC8-type 1 | 10090 | MGI:1861457 | Inparanoid, OMA, EggNOG |
| Rat | 58945 | Dynll1 | dynein light chain LC8-type 1 | 10116 | RGD:619866 | Inparanoid, OMA |
| Dog | 609233 | DYNLL1 | dynein light chain LC8-type 1 | 9615 | VGNC:40150 | Inparanoid, OMA, EggNOG |
| Horse | 100053227 | DYNLL1 | dynein light chain LC8-type 1 | 9796 | VGNC:17372 | Inparanoid, OMA |
| Cow | 404151 | DYNLL1 | dynein light chain LC8-type 1 | 9913 | Inparanoid, EggNOG | |
| Pig | 100157773 | DYNLL1 | dynein light chain LC8-type 1 | 9823 | OMA, EggNOG | |
| Opossum | 100018529 | DYNLL1 | dynein light chain LC8-type 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100079619 | DYNLL1 | dynein light chain LC8-type 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100552740 | dynll1 | dynein light chain LC8-type 1 | 28377 | Inparanoid, OMA | |
| Zebrafish | 572690 | dynll2b | dynein, light chain, LC8-type 2b | 7955 | ZDB-GENE-050320-132 | OMA, EggNOG |
| S.cerevisiae | 852034 | DYN2 | dynein light chain | 4932 | S000002832 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
protein / cytoskeletal protein / enzyme modulator / Dynein light chain 1, cytoplasmic
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
protein / cytoskeletal protein / enzyme modulator / Dynein light chain 1, cytoplasmic
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later