JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

NUS1

Description	Dehydrodolichyl diphosphate synthase complex subunit NUS1

Gene and Protein Information

Gene ID	116150
Uniprot Accession IDs	Q96E22 B2RWQ4 O00251
Ensembl ID	ENSG00000153989
Symbol	C6orf68 NGBR NgBR MRD55 CDG1AA C6orf68 TANGO14 MGC:7199
Chromosome	6
Family	Belongs to the UPP synthase family.
Sequence	MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462965	NUS1	NUS1 dehydrodolichyl diphosphate synthase subunit	9598		OMA, EggNOG
Mouse	52014	Nus1	NUS1 dehydrodolichyl diphosphate synthase subunit	10090	MGI:1196365	Inparanoid, OMA, EggNOG
Rat	294400	Nus1	NUS1 dehydrodolichyl diphosphate synthase subunit	10116	RGD:1307879	Inparanoid, OMA, EggNOG
Dog	484102	NUS1	NUS1, dehydrodolichyl diphosphate synthase subunit	9615	VGNC:44066	Inparanoid, OMA, EggNOG
Horse	100067138	NUS1	NUS1, dehydrodolichyl diphosphate synthase subunit	9796	VGNC:20979	Inparanoid, OMA, EggNOG
Pig	100154658	NUS1	NUS1 dehydrodolichyl diphosphate synthase subunit	9823		OMA, EggNOG
Opossum	100023437	NUS1	NUS1 dehydrodolichyl diphosphate synthase subunit	13616		Inparanoid, OMA, EggNOG
Chicken	421733	NUS1	NUS1 dehydrodolichyl diphosphate synthase subunit	9031	CGNC:11057	Inparanoid, OMA, EggNOG
Anole lizard	100553689	nus1	NUS1 dehydrodolichyl diphosphate synthase subunit	28377		Inparanoid, OMA, EggNOG
Xenopus	548844	nus1	NUS1 dehydrodolichyl diphosphate synthase subunit	8364	XB-GENE-981164	Inparanoid, OMA, EggNOG
Zebrafish	436629	nus1	NUS1, dehydrodolichyl diphosphate synthase subunit	7955	ZDB-GENE-040718-48	Inparanoid, OMA, EggNOG
Fruitfly	33298	Tango14	Transport and Golgi organization 14	7227	FBgn0031312	Inparanoid, EggNOG
S.cerevisiae	851334	NUS1	ditrans,polycis-polyprenyl diphosphate synthase	4932	S000002352	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.