Il s'agit d'un magasin de démonstration. Aucune commande ne sera honorée.
| Description | Proliferating cell nuclear antigen |
|---|
Gene and Protein Information
| Gene ID | 5111 |
|---|---|
| Uniprot Accession IDs | P12004 B2R897 D3DW02 PCNA |
| Ensembl ID | ENSG00000132646 |
| Symbole | ATLD2 |
| Chromosome | 20 |
| Family | Belongs to the PCNA family. |
| Sequence |
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458081 | PCNA | proliferating cell nuclear antigen | 9598 | VGNC:6229 | OMA, EggNOG |
| Macaque | 718006 | PCNA | proliferating cell nuclear antigen | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18538 | Pcna | proliferating cell nuclear antigen | 10090 | MGI:97503 | OMA, EggNOG |
| Mouse | 18540 | Pcna-ps2 | proliferating cell nuclear antigen pseudogene 2 | 10090 | MGI:97505 | Inparanoid, OMA |
| Rat | 25737 | Pcna | proliferating cell nuclear antigen | 10116 | RGD:3269 | Inparanoid, OMA, EggNOG |
| Dog | 477166 | PCNA | proliferating cell nuclear antigen | 9615 | VGNC:44310 | Inparanoid, OMA, EggNOG |
| Horse | 100052065 | PCNA | proliferating cell nuclear antigen | 9796 | VGNC:21207 | Inparanoid, OMA, EggNOG |
| Cow | 515499 | PCNA | proliferating cell nuclear antigen | 9913 | VGNC:32635 | Inparanoid, OMA, EggNOG |
| Pig | 692192 | PCNA | proliferating cell nuclear antigen | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100029293 | PCNA | proliferating cell nuclear antigen | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100560949 | pcna | proliferating cell nuclear antigen | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 493302 | pcna | proliferating cell nuclear antigen | 8364 | XB-GENE-972522 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30678 | pcna | proliferating cell nuclear antigen | 7955 | ZDB-GENE-000210-8 | Inparanoid, OMA, EggNOG |
| C. elegans | 177161 | pcn-1 | Proliferating cell nuclear antigen | 6239 | Inparanoid, OMA | |
| Fruitfly | 37290 | PCNA | Proliferating cell nuclear antigen | 7227 | FBgn0005655 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 852385 | POL30 | proliferating cell nuclear antigen | 4932 | S000000292 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA polymerase processivity factor / Proliferating cell nuclear antigen
protein / nucleic acid binding / DNA polymerase processivity factor / Proliferating cell nuclear antigen
DTO Classes
protein / Nucleic acid binding / DNA binding protein / DNA polymerase processivity factor / Proliferating cell nuclear antigen
protein / Nucleic acid binding / DNA binding protein / DNA polymerase processivity factor / Proliferating cell nuclear antigen
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later