This is a demo store. No orders will be fulfilled.

PHB

Description Prohibitin

Gene and Protein Information

Gene ID 5245
Uniprot Accession IDs P35232 B4DY47 Q4VBQ0
Ensembl ID ENSP00000479488
Symbol PHB1 HEL-215 HEL-S-54e
Chromosome 17
Family Belongs to the prohibitin family.
Sequence
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 455205 PHB prohibitin 9598 VGNC:9514 OMA, EggNOG
Macaque 699334 PHB prohibitin 9544 OMA, EggNOG
Mouse 18673 Phb prohibitin 10090 MGI:97572 Inparanoid, OMA, EggNOG
Rat 25344 Phb prohibitin 10116 RGD:3322 Inparanoid, OMA, EggNOG
Dog 480547 PHB prohibitin 9615 Inparanoid, OMA, EggNOG
Horse 100056039 PHB prohibitin 9796 VGNC:21368 Inparanoid, OMA, EggNOG
Cow 530409 PHB prohibitin 9913 VGNC:32808 Inparanoid, OMA, EggNOG
Pig 100524707 PHB prohibitin 9823 OMA, EggNOG
Opossum 100618482 PHB prohibitin 13616 Inparanoid, OMA, EggNOG
Anole lizard 100564329 phb prohibitin 28377 OMA, EggNOG
Xenopus 394635 phb prohibitin 8364 XB-GENE-977670 Inparanoid, OMA, EggNOG
Zebrafish 321346 phb prohibitin 7955 ZDB-GENE-030131-6577 Inparanoid, OMA
C. elegans 171768 phb-1 Mitochondrial prohibitin complex protein 1 6239 Inparanoid, OMA
Fruitfly 49168 l(2)37Cc lethal (2) 37Cc 7227 FBgn0002031 Inparanoid, EggNOG
S.cerevisiae 853033 PHB1 prohibitin subunit PHB1 4932 S000003364 Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.